PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_25607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 312aa    MW: 35586.5 Da    PI: 6.9488
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_25607genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.2e-072492822154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  PEQU_25607 249 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 282
                 469*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.6E-163882IPR005540KNOX1
PfamPF037909.2E-154081IPR005540KNOX1
SMARTSM012565.4E-2493148IPR005541KNOX2
PfamPF037918.9E-1799147IPR005541KNOX2
PROSITE profilePS5007111.92223286IPR001356Homeobox domain
SuperFamilySSF466893.85E-16225291IPR009057Homeodomain-like
SMARTSM003897.6E-11225290IPR001356Homeobox domain
CDDcd000863.10E-12226287No hitNo description
Gene3DG3DSA:1.10.10.602.4E-25230289IPR009057Homeodomain-like
PfamPF059201.1E-17243282IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MRGDPHQVHG MHMSAAAAVG ECSTSAPPSA AAEEEHRRLL KAEISVHPLL EQLLSAHVGC  60
LRVATPIDQL PLIDAQLSQS HHLLRSYAAI HRPLLSPPEK HDLDNFLTQY TLLLCSFKEQ  120
LQQHVRVHAV EAVMACREIE QSLHELTGVT LDEGTGATMS DDEDDLQLDC SLDPLMDGHD  180
LMGFGPLLPS ESERSLMERA LFCFLYVRFQ GFRSKIEDVR EEIMRKRRAG KLPGDTTSVL  240
KQWWQQHSKW PYPTEDDKAK LVEETGLQLK QINNWFINQR KRNWHNNSQS ATSCSKSKRK  300
RYFSRCTLYI KP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279300RKRNWHNNSQSATSCSKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933995.11e-163PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotQ94LW31e-148KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLM0RWS41e-161M0RWS4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03660_0011e-160(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-143KNOTTED-like homeobox of Arabidopsis thaliana 7